DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment moody and mtnr1al

DIOPT Version :9

Sequence 1:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001153381.1 Gene:mtnr1al / 30660 ZFINID:ZDB-GENE-990415-154 Length:318 Species:Danio rerio


Alignment Length:359 Identity:82/359 - (22%)
Similarity:143/359 - (39%) Gaps:86/359 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTFAAVMTFL------IMIVGICGNLLTVVALLKCPKVRNVAAAFIISLCIADLLFCALVLPFQG 94
            |:|..|:|.|      .::|.:.||||.:|::.:..|:|....||::||.|||||......|...
Zfish    22 LSFPWVVTLLSSVLITTIVVDVLGNLLVIVSVFRNRKLRKAGNAFVVSLAIADLLVAIYPYPLVL 86

  Fly    95 LRFVQGTWRHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAA 159
            .......|..|.:.|::..|:...::..|:..|..|.||||..|.|...|.:::........:..
Zfish    87 TAIFHDRWIAGDIHCQISGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLFSNKNTVCYVIL 151

  Fly   160 CWLFSYGMQLPTLLGEWGRFGYDSRLQTCSIMTDDHGHSSKTTLFITA--FVIPCLVIIACYAKI 222
            .|..:....:|....|  ...||.|:.:|   |.....||..|:.:..  |::|..::..||.:|
Zfish   152 VWALTVLAIVPNWFVE--SLQYDPRVFSC---TFAQSVSSLYTIMVVVVHFIVPIGIVTYCYLRI 211

  Fly   223 FWVVHKSEQRLKRHATKQNSIPNNLRPLASTGSGALPSGAECQPSNRVSSDSSSSFSIDVPETAP 287
            :.:|.:..:|:|                                                |::.|
Zfish   212 WILVIQVRRRVK------------------------------------------------PDSRP 228

  Fly   288 SGKQQPTRVKDQREVRAKRNEWRITKMVLAIFLSFVVCYLPITIVKVADKNVEHPS--------L 344
                           :.|.:::|....:..:|:.|.||:.|:..:.:|  ...||.        |
Zfish   229 ---------------KIKPHDFRNFLTMFVVFVLFAVCWAPLNFIGLA--VAIHPRLGQSIPEWL 276

  Fly   345 HICSYILLYLSACINPIIYVIMNKQYRKAYKTVV 378
            ...||.:.|.::|:|.:||.::|..:||.||.:|
Zfish   277 FTASYFMAYFNSCLNGVIYGVLNHNFRKEYKRIV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 34/128 (27%)
7tm_1 53..363 CDD:278431 68/319 (21%)
7tm_4 <310..380 CDD:304433 23/77 (30%)
mtnr1alNP_001153381.1 7tm_4 43..>211 CDD:304433 46/172 (27%)
7tm_1 45..295 CDD:278431 68/319 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5631
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321514at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.