DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment moody and GPR15

DIOPT Version :9

Sequence 1:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_005281.1 Gene:GPR15 / 2838 HGNCID:4469 Length:360 Species:Homo sapiens


Alignment Length:396 Identity:88/396 - (22%)
Similarity:141/396 - (35%) Gaps:116/396 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FAAVMTFLIMIVGICGNLLTVVALLKCPKVRNVAAAFIISLCIADLLFCALVLPFQGLRFVQGTW 102
            |..|....:.:.|:.|||:.:.||...|..|.:...|||:|..:|.:|...:..:.......|.|
Human    35 FLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLW 99

  Fly   103 RHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAACWLFSYGM 167
            |.|..||:...::...|:..|:|.:..::::||:.|....:..:..:.....|:.|:.|..|..:
Human   100 RTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLL 164

  Fly   168 QLPTLLGEWGRFGYDSRLQTCSIMTDDHGH--SSKTT---------LFITAFVIPCLVIIACYAK 221
            .|||||         ||..|   :.||..:  ..|.|         ..|..|.:|.|.|:.||..
Human   165 GLPTLL---------SRELT---LIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCC 217

  Fly   222 IFWVVHKSEQRLKRHATKQNSIPNNLRPLASTGSGALPSGAECQPSNRVSSDSSSSFSIDVPETA 286
            |       .::|..|..:                                               
Human   218 I-------ARKLCAHYQQ----------------------------------------------- 228

  Fly   287 PSGKQQPTRVKDQREVRAKRNEWRITKMVLAIFLSFVVCYLPITIVK----VADKNVEH--PSLH 345
             |||......|.             .|::..:..:|:|.:||....|    |:....||  ||..
Human   229 -SGKHNKKLKKS-------------IKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAI 279

  Fly   346 I-----CSYILLYLSACINPIIYVIMNKQYRKAYKTVVFCQPARLLLPFGKTNGASSAAEKWKDT 405
            :     .|..|.:.::|:||.||.|.:...|:|   :|.|     |.|..|.....|:.|     
Human   280 LQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRA---IVHC-----LCPCLKNYDFGSSTE----- 331

  Fly   406 GLSNNH 411
             .|::|
Human   332 -TSDSH 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 30/122 (25%)
7tm_1 53..363 CDD:278431 71/331 (21%)
7tm_4 <310..380 CDD:304433 22/80 (28%)
GPR15NP_005281.1 7tmA_GPR15 34..313 CDD:320322 79/360 (22%)
TM helix 1 35..61 CDD:320322 8/25 (32%)
TM helix 2 68..93 CDD:320322 6/24 (25%)
TM helix 3 106..136 CDD:320322 6/29 (21%)
TM helix 4 150..168 CDD:320322 5/17 (29%)
TM helix 5 192..221 CDD:320322 8/35 (23%)
TM helix 6 234..264 CDD:320322 7/42 (17%)
TM helix 7 281..306 CDD:320322 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.