DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment moody and Mtnr1a

DIOPT Version :9

Sequence 1:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_032665.1 Gene:Mtnr1a / 17773 MGIID:102967 Length:353 Species:Mus musculus


Alignment Length:380 Identity:85/380 - (22%)
Similarity:152/380 - (40%) Gaps:99/380 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TFAAVMTFLIMIVGICGNLLTVVALLKCPKVRNVAAAFIISLCIADLLFCALVLPFQGLRFVQGT 101
            |.|.::.|.| :|.|.||||.::::.:..|:||....|::||.:|||:......|......:...
Mouse    32 TLAFILIFTI-VVDILGNLLVILSVYRNKKLRNSGNIFVVSLAVADLVVAVYPYPLVLTSILNNG 95

  Fly   102 WRHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAACWLFSYG 166
            |..|.:.|::..|:...::..|:..|..|.:|||..|.|...|.:||........:...|:.:..
Mouse    96 WNLGYLHCQVSAFLMGLSVIGSIFNITGIAMNRYCYICHSLKYDKIYSNKNSLCYVFLIWMLTLI 160

  Fly   167 MQLPTLLGEWGRFGYDSRLQTCSIMTDDHGHSSKTTLFITA--FVIPCLVIIACYAKIFWVVHKS 229
            ..:|.|  :.|...||.|:.:|   |.....||..|:.:..  |::|.:::|.||.:| ||:...
Mouse   161 AIMPNL--QTGTLQYDPRIYSC---TFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRI-WVLVLQ 219

  Fly   230 EQRLKRHATKQNSIPNNLRPLASTGSGALPSGAECQPSNRVSSDSSSSFSIDVPETAPSGKQQPT 294
            .:|                                                              
Mouse   220 VRR-------------------------------------------------------------- 222

  Fly   295 RVKDQREVRAKRNEWRITKMVLAIFLSFVVCYLPITIVKV---ADKNVEHPS----LHICSYILL 352
            |||...:.:.|..::|....:..:|:.|.:|:.|:.::.:   :|.....|.    |.:.||.|.
Mouse   223 RVKPDNKPKLKPQDFRNFVTMFVVFVLFAICWAPLNLIGLIVASDPATMVPRIPEWLFVASYYLA 287

  Fly   353 YLSACINPIIYVIMNKQYRKAYKTVVF---------------------CQPARLL 386
            |.::|:|.|||.::|:.:||.||.::.                     |:|:.|:
Mouse   288 YFNSCLNAIIYGLLNQNFRKEYKKIIVSLCTAKMFFVESSNEEADKIKCKPSPLI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 34/122 (28%)
7tm_1 53..363 CDD:278431 69/318 (22%)
7tm_4 <310..380 CDD:304433 22/97 (23%)
Mtnr1aNP_032665.1 7tm_4 38..>160 CDD:304433 34/122 (28%)
7tm_1 47..298 CDD:278431 69/318 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5667
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4435
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.