DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment moody and Bdkrb1

DIOPT Version :9

Sequence 1:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_031565.1 Gene:Bdkrb1 / 12061 MGIID:88144 Length:334 Species:Mus musculus


Alignment Length:407 Identity:78/407 - (19%)
Similarity:150/407 - (36%) Gaps:116/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDETTISLEDGYPPLEALTTMVPP--ADATGFSQSLLTFAAVMTFLIMIV---GICGNLLTVVA 60
            |:.:.::.|:......:|     ||  ....|..::......|:...::.|   |:.|||| |::
Mouse     1 MASQASLKLQPSNQSQQA-----PPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLL-VLS 59

  Fly    61 LLKCPKVR---------NVAAAFIISLCIADLLFCALVLPF----QGLRFVQGTWRHGQVLCRLI 112
            ....|..|         .:|..::.:|..:||:| .|.|||    .|.||   .|..|..|||::
Mouse    60 FFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVF-VLGLPFWAENVGNRF---NWPFGSDLCRVV 120

  Fly   113 PFIQYGNIGVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAACWLFSYGMQLPTLLGEWG 177
            ..:...|:.:|:..:..|:.:||.::.:.                               :..||
Mouse   121 SGVIKANLFISIFLVVAISQDRYRLLVYP-------------------------------MTSWG 154

  Fly   178 RFGYDSRLQTCSIMTDDHG-HSSKTTLFITAFVIPCLVIIACYAKIFWVVHKSEQRLKRHATKQN 241
            .........||.::....| .|:.|.|..:..|:|.|.|.||   |....|::...::   ..:.
Mouse   155 NRRRRQAQVTCLLIWVAGGLLSTPTFLLRSVKVVPDLNISAC---ILLFPHEAWHFVR---MVEL 213

  Fly   242 SIPNNLRPLASTGSGALPSGAECQPSNRVSSDSSSSFSIDVPETAPSGKQQPTRV-----KDQRE 301
            ::...|.|||:.                      ..|:..:..:. .|:::.:|.     ||.:.
Mouse   214 NVLGFLLPLAAI----------------------LYFNFHILASL-RGQKEASRTRCGGPKDSKT 255

  Fly   302 VRAKRNEWRITKMVLAIFLSFVVCYLPITIVKVADKNVEHPSLHICSY------------ILLYL 354
            :          .::|.:..||:||:.|.......|..|:...:..|.:            ...::
Mouse   256 M----------GLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLGLQLANFFAFV 310

  Fly   355 SACINPIIYVIMNKQYR 371
            ::|:||:|||...:.::
Mouse   311 NSCLNPLIYVFAGRLFK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 31/138 (22%)
7tm_1 53..363 CDD:278431 66/340 (19%)
7tm_4 <310..380 CDD:304433 15/74 (20%)
Bdkrb1NP_031565.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/24 (17%)
7tm_1 77..319 CDD:278431 59/315 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.