DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment moody and Agtr2

DIOPT Version :9

Sequence 1:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_031455.1 Gene:Agtr2 / 11609 MGIID:87966 Length:363 Species:Mus musculus


Alignment Length:391 Identity:82/391 - (20%)
Similarity:148/391 - (37%) Gaps:122/391 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DATGFSQSL-----------LTFAAVMTFLIMIVGICGNLLTVVALLKCPK-VRNVAAAFIISLC 79
            :|||.::|.           |....|:.::|.::|...|:: ||:|..|.| .:.|::.:|.:|.
Mouse    24 NATGTNESAFNCSHKPSDKHLEAIPVLYYMIFVIGFAVNIV-VVSLFCCQKGPKKVSSIYIFNLA 87

  Fly    80 IADLLFCALVLP----FQGLRFVQGTWRHGQVLCRLIPFIQYGNIGVSLLCIAMITINRYVMITH 140
            :||||..| .||    :...|:   .|..|.|:|::.......|:..|:..|..::::||..:.:
Mouse    88 LADLLLLA-TLPLWATYYSYRY---DWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIY 148

  Fly   141 HGLYARIYKRHWIA-VMIAACWLFSYGMQLPTLLGEWGRFGYDSR------LQTCSIMTDDHGH- 197
            ..|..|  :..|.| .::...|..:....|||.      :..|.|      :..|.:......: 
Mouse   149 PFLSQR--RNPWQASYVVPLVWCMACLSSLPTF------YFRDVRTIEYLGVNACIMAFPPEKYA 205

  Fly   198 --SSKTTLF--ITAFVIPCLVIIACYAKIFWVVHKSEQRLKRHATKQNSIPNNLRPLASTGSGAL 258
              |:...|.  |..|:||.:.|..||..|           ::|..|.||.               
Mouse   206 QWSAGIALMKNILGFIIPLIFIATCYFGI-----------RKHLLKTNSY--------------- 244

  Fly   259 PSGAECQPSNRVSSDSSSSFSIDVPETAPSGKQQPTRVKDQREVRAKRNEWRITKMVLAIFLSFV 323
                                          ||.:.||  ||           :.||..|:.|:|:
Mouse   245 ------------------------------GKNRITR--DQ-----------VLKMAAAVVLAFI 266

  Fly   324 VCYLPITIVKVADKNVEHPSLHICSYI------------LLYLSACINPIIYVIMNKQYRKAYKT 376
            :|:||..::...|.......::.|..|            |.:.::|:||.:|..:..::::..::
Mouse   267 ICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRS 331

  Fly   377 V 377
            |
Mouse   332 V 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 33/128 (26%)
7tm_1 53..363 CDD:278431 72/338 (21%)
7tm_4 <310..380 CDD:304433 17/80 (21%)
Agtr2NP_031455.1 7tm_1 62..318 CDD:278431 72/337 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24228
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.