DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npepl1 and S-Lap4

DIOPT Version :9

Sequence 1:XP_006235750.1 Gene:Npepl1 / 311671 RGDID:1311351 Length:524 Species:Rattus norvegicus
Sequence 2:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster


Alignment Length:391 Identity:92/391 - (23%)
Similarity:148/391 - (37%) Gaps:64/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat   138 SGASRRTEKRTVMVEFFLVGQD------NGPVEVSTLQCLTNA---------------------T 175
            :|...|:.:...:.|.|:.|.|      .|.|......|..|:                     |
  Fly   126 AGIGARSLQEIGVSEVFVDGMDYAEQAAEGAVLAVWRYCDMNSKRKPPHIPKLELYESPDYEGWT 190

  Rat   176 EGV------RLAARIVDTPCSEMNTDIFLEEISQVGRELGITPTIIRDEQLKTKGFGGIYGVGKA 234
            .||      .||.|:.|||...|...:|.:.........|||..|...|.::.:.......:.|.
  Fly   191 RGVFKAEAQNLARRMCDTPACCMTPTLFAQATVDALCPCGITVEIRTMEWIEQQRLHSFLMIAKG 255

  Rat   235 ALHPPALAVLSH---TPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFRA 296
            :..||.|..:::   .|:  .:.|.::||||.:::|.::::....|...:....|||:.:...|.
  Fly   256 SCEPPVLMEITYCGTNPE--DKPILFLGKGITFNSGAMNLRKCRGMEEYRACMSGAASCVAMMRC 318

  Rat   297 AIKQGFKDNLHAVFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLG 361
            ........|:..:..|.||.....|.:|.|:..|.:.|::.:.|.|..|.:|:||.:.|......
  Fly   319 VAALALPINVCCIIPLCENMPSGMACKPGDVVTLMNHKSMAVRNLDKAGVVVMADPLLYGQSTYK 383

  Rat   362 ADIIVDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGQKCGDLVHPLVYCPELHF--SEFTS 424
            ..::||:|||......|.|.....:.:||.........||...||.|..|   |..::  .:.|.
  Fly   384 PRLVVDVATLGSGVKKAFGGGATGIFSNSHYIWKQFQSAGALTGDRVWRL---PLWNYYRKQITD 445

  Rat   425 AVA-DMKNSVADRDNSPSSCAGLFIASHIGFDWPGV-WVHLDIAAPVHAGERATGFGVALLLALF 487
            .:. |:.|   |.....:||....:...:   .|.| |.|||        .|.||     ||..:
  Fly   446 EMGYDLSN---DGRGLANSCLAAAVLHEL---VPCVDWAHLD--------TRGTG-----LLTKY 491

  Rat   488 G 488
            |
  Fly   492 G 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npepl1XP_006235750.1 Peptidase_M17 35..487 CDD:238247 91/388 (23%)
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 92/391 (24%)
Peptidase_M17 35..514 CDD:238247 92/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.