DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and AT1G60360

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_176239.1 Gene:AT1G60360 / 842331 AraportID:AT1G60360 Length:327 Species:Arabidopsis thaliana


Alignment Length:109 Identity:30/109 - (27%)
Similarity:43/109 - (39%) Gaps:17/109 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLDFEE-------- 64
            ||:|.|.|....:.....|.|.:|:||:..|.:.:.:||||| :|........:..|        
plant   224 CTVCMEEFIVGGDATELPCKHIYHKDCIVPWLRLNNSCPICR-RDLPLVNTVAESRERSNPIRQD 287

  Fly    65 FPESASAQ----GGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSS 104
            .||....:    |..|....|.|..|...::    |.|..||.|
plant   288 MPERRRPRWMQLGNIWPFRARYQRVSPEETA----NQNPRDNRS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 14/40 (35%)
AT1G60360NP_176239.1 zinc_ribbon_9 24..56 CDD:433910
RAD18 199..>325 CDD:227719 27/105 (26%)
RING_Ubox 223..265 CDD:473075 14/40 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.