DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and AT5G15790

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001331488.1 Gene:AT5G15790 / 831435 AraportID:AT5G15790 Length:263 Species:Arabidopsis thaliana


Alignment Length:65 Identity:17/65 - (26%)
Similarity:26/65 - (40%) Gaps:8/65 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLDFEEFPESASA 71
            :|..|.|.:.:.:......|.|.||..|:..|.::|..||:|...:.        |...|...||
plant   181 VCPTCLEEYISENPKIVTKCSHHFHLSCIYEWMERSENCPVCGKVNT--------FHVLPSQFSA 237

  Fly    72  71
            plant   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 12/41 (29%)
AT5G15790NP_001331488.1 RING-H2_AIRP1-like 178..225 CDD:438478 13/43 (30%)

Return to query results.
Submit another query.