DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and AIRP1

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001190812.1 Gene:AIRP1 / 828444 AraportID:AT4G23450 Length:208 Species:Arabidopsis thaliana


Alignment Length:41 Identity:15/41 - (36%)
Similarity:21/41 - (51%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPIC 48
            |.||.|.:...:......|||.||..|:..|.::|..||:|
plant   159 CPICLEEYEIDNPKLLTKCGHDFHLACILAWMERSEACPVC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 15/41 (37%)
AIRP1NP_001190812.1 RING-H2_AIRP1-like 155..203 CDD:438478 15/41 (37%)

Return to query results.
Submit another query.