DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and RHA1A

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_192876.1 Gene:RHA1A / 826739 AraportID:AT4G11370 Length:159 Species:Arabidopsis thaliana


Alignment Length:72 Identity:24/72 - (33%)
Similarity:33/72 - (45%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNI-QAGSCGHAFHEDCLDHW--RKQSRTCPICRSQDAAYFQLYLDFEEFPESA 69
            ||:|...|.:.|.: |...|||.||..|||.|  ......||:||.:       :|..|::.:|.
plant    86 CTVCLSDFESDDKVRQLPKCGHVFHHYCLDRWIVDYNKMKCPVCRHR-------FLPKEKYTQSD 143

  Fly    70 SAQGGSW 76
            ...|..|
plant   144 WGSGSDW 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 17/43 (40%)
RHA1ANP_192876.1 RING-H2_RHA1-like 83..133 CDD:438483 19/53 (36%)

Return to query results.
Submit another query.