DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and AT4G09120

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_192651.1 Gene:AT4G09120 / 826490 AraportID:AT4G09120 Length:345 Species:Arabidopsis thaliana


Alignment Length:99 Identity:31/99 - (31%)
Similarity:44/99 - (44%) Gaps:11/99 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRNNVICTICSERFRTSDNIQ-AGSCGHAFHEDCLDHWRKQSRTCPICRSQ-----DAAYFQLY 59
            :|:..|.|.||...|...:.:: ...|.|.||.:|:|.|.....|||:||:.     ..:|..|.
plant   116 IGKGGVECAICLSEFEDQETLRWMPPCSHTFHANCIDVWLSSWSTCPVCRANLSLKPGESYPYLN 180

  Fly    60 LDFE-----EFPESASAQGGSWGGHNRSQGHSSS 88
            :|.|     :.|...|..|.|....:||.|..||
plant   181 MDVETGGVQKLPNERSLTGNSVTTRSRSTGLLSS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 14/42 (33%)
AT4G09120NP_192651.1 PEX10 <83..171 CDD:227861 18/54 (33%)
RING-H2_EL5-like 122..165 CDD:438124 14/42 (33%)

Return to query results.
Submit another query.