DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and AT4G09120

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_192651.1 Gene:AT4G09120 / 826490 AraportID:AT4G09120 Length:345 Species:Arabidopsis thaliana


Alignment Length:99 Identity:31/99 - (31%)
Similarity:44/99 - (44%) Gaps:11/99 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRNNVICTICSERFRTSDNIQ-AGSCGHAFHEDCLDHWRKQSRTCPICRSQ-----DAAYFQLY 59
            :|:..|.|.||...|...:.:: ...|.|.||.:|:|.|.....|||:||:.     ..:|..|.
plant   116 IGKGGVECAICLSEFEDQETLRWMPPCSHTFHANCIDVWLSSWSTCPVCRANLSLKPGESYPYLN 180

  Fly    60 LDFE-----EFPESASAQGGSWGGHNRSQGHSSS 88
            :|.|     :.|...|..|.|....:||.|..||
plant   181 MDVETGGVQKLPNERSLTGNSVTTRSRSTGLLSS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 14/41 (34%)
Prefoldin 112..>151 CDD:298833
AT4G09120NP_192651.1 zf-RING_2 122..165 CDD:290367 14/42 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.