DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and RDUF1

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_190246.1 Gene:RDUF1 / 823815 AraportID:AT3G46620 Length:395 Species:Arabidopsis thaliana


Alignment Length:54 Identity:18/54 - (33%)
Similarity:25/54 - (46%) Gaps:6/54 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLD 61
            |.:|:|.|......:...|.|.||.||:..|.....:||:||      |:|..|
plant   215 CAVCTEVFEAGIEGREMPCKHIFHGDCIVPWLSIRNSCPVCR------FELPSD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 13/40 (33%)
RDUF1NP_190246.1 zinc_ribbon_9 30..65 CDD:433910
RING_Ubox 214..256 CDD:473075 13/40 (33%)
DUF1117 274..393 CDD:399509
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.