DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and AT3G19950

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001326918.1 Gene:AT3G19950 / 821533 AraportID:AT3G19950 Length:386 Species:Arabidopsis thaliana


Alignment Length:80 Identity:22/80 - (27%)
Similarity:37/80 - (46%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLDFEEFPESASAQ 72
            |.:|.:.|....:::...|.|.||:|||..|.:...:||:||      |:|..|..::...:...
plant   274 CAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLELHNSCPVCR------FELPTDDPDYENRSQGS 332

  Fly    73 GGSWGGHNRSQGHSS 87
            .||..|....:|..:
plant   333 QGSGDGQGSVEGQQT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 13/40 (33%)
AT3G19950NP_001326918.1 zinc_ribbon_9 78..111 CDD:433910
RING-H2_RNF126-like 273..315 CDD:438329 13/40 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.