DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and AT2G34000

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_180947.1 Gene:AT2G34000 / 817961 AraportID:AT2G34000 Length:151 Species:Arabidopsis thaliana


Alignment Length:49 Identity:16/49 - (32%)
Similarity:25/49 - (51%) Gaps:3/49 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NN--VICTICSERFRTSDNIQA-GSCGHAFHEDCLDHWRKQSRTCPICR 49
            ||  :.|.:|......:..|:. .:|.|.|.|:|:..|.:...|||:||
plant    85 NNQEIECPVCLGLIPKNVVIKVLPNCMHMFDEECIGKWLESHATCPVCR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 12/42 (29%)
AT2G34000NP_180947.1 RING_Ubox 90..133 CDD:473075 12/42 (29%)

Return to query results.
Submit another query.