DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and RNF122

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_079063.2 Gene:RNF122 / 79845 HGNCID:21147 Length:155 Species:Homo sapiens


Alignment Length:47 Identity:17/47 - (36%)
Similarity:23/47 - (48%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAA 54
            |.:|.|.|:..|.:....|.||||..||..|.:....||:|....|:
Human    93 CAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIAS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 15/40 (38%)
RNF122NP_079063.2 RING-H2_RNF122 91..137 CDD:438338 16/43 (37%)

Return to query results.
Submit another query.