DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and RNF128

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_919445.1 Gene:RNF128 / 79589 HGNCID:21153 Length:428 Species:Homo sapiens


Alignment Length:158 Identity:38/158 - (24%)
Similarity:70/158 - (44%) Gaps:26/158 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRNNVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLDFEEF 65
            :|.:...|.:|.|.::.:|.::..:|.|.||:.|:|.|..:.||||:|:........:.:|.|: 
Human   270 IGPDGDSCAVCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVED- 333

  Fly    66 PESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSSSDDYIGIMREYENLLYETGVYREEIE 130
             .|.|.|         ....:..|:|.||:..::...::|..|..:....|..|      .|.::
Human   334 -GSVSLQ---------VPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPL------EEHVQ 382

  Fly   131 YLNQRIGALTVLNAELSKLHECSDSDVD 158
            ..|:   :|.::|      ||.:...||
Human   383 STNE---SLQLVN------HEANSVAVD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 15/41 (37%)
RNF128NP_919445.1 PA_GRAIL_like 48..193 CDD:239037
RING-H2_RNF128-like 275..323 CDD:438454 16/47 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..428 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.