DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and rnf150b

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001017554.1 Gene:rnf150b / 792211 ZFINID:ZDB-GENE-050417-470 Length:419 Species:Danio rerio


Alignment Length:66 Identity:21/66 - (31%)
Similarity:33/66 - (50%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICR----------SQDAAYFQLYLDF 62
            |.:|.|.::.:|.::...|.|.||:.|:|.|....||||:|:          |......:|.||:
Zfish   267 CAVCIEGYKPNDVVRILPCRHLFHKCCVDPWLVDHRTCPMCKMNILKALGLTSSAECLNELPLDY 331

  Fly    63 E 63
            |
Zfish   332 E 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 15/40 (38%)
Prefoldin 112..>151 CDD:298833
rnf150bNP_001017554.1 PA_GRAIL_like 45..182 CDD:239037
UPF0233 <196..>221 CDD:299753
zf-RING_2 265..308 CDD:290367 15/40 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.