powered by:
Protein Alignment CG4325 and rnf150b
DIOPT Version :9
Sequence 1: | NP_001259169.1 |
Gene: | CG4325 / 31167 |
FlyBaseID: | FBgn0026878 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017554.1 |
Gene: | rnf150b / 792211 |
ZFINID: | ZDB-GENE-050417-470 |
Length: | 419 |
Species: | Danio rerio |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 33/66 - (50%) |
Gaps: | 10/66 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICR----------SQDAAYFQLYLDF 62
|.:|.|.::.:|.::...|.|.||:.|:|.|....||||:|: |......:|.||:
Zfish 267 CAVCIEGYKPNDVVRILPCRHLFHKCCVDPWLVDHRTCPMCKMNILKALGLTSSAECLNELPLDY 331
Fly 63 E 63
|
Zfish 332 E 332
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000832 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.