powered by:
Protein Alignment CG4325 and TTC3
DIOPT Version :9
Sequence 1: | NP_001259169.1 |
Gene: | CG4325 / 31167 |
FlyBaseID: | FBgn0026878 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016883947.1 |
Gene: | TTC3 / 7267 |
HGNCID: | 12393 |
Length: | 2081 |
Species: | Homo sapiens |
Alignment Length: | 87 |
Identity: | 29/87 - (33%) |
Similarity: | 37/87 - (42%) |
Gaps: | 19/87 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLDFEEFPESASAQ 72
|.||.|.|: |.|::...|||.:|:.|...|.|....||.|:.:| |..||.| .
Human 2013 CEICHEVFK-SKNVRVLKCGHKYHKGCFKQWLKGQSACPACQGRD-------LLTEESP-----S 2064
Fly 73 GGSWGGHNRSQGHSSSSSSCSS 94
|..|...|: ...||||
Human 2065 GRGWPSQNQ------ELPSCSS 2080
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG4325 | NP_001259169.1 |
zf-RING_2 |
8..49 |
CDD:290367 |
16/40 (40%) |
Prefoldin |
112..>151 |
CDD:298833 |
|
TTC3 | XP_016883947.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S7158 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.