DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and Rnf128

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_075759.3 Gene:Rnf128 / 66889 MGIID:1914139 Length:428 Species:Mus musculus


Alignment Length:142 Identity:33/142 - (23%)
Similarity:64/142 - (45%) Gaps:12/142 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRNNVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLDFEEF 65
            :|.:...|.:|.|.::.:|.::..:|.|.||:.|:|.|..:.||||:|:........:.:|.|: 
Mouse   270 IGPDGDSCAVCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVED- 333

  Fly    66 PESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSSSDDYIGIMREYENLLYE-TGVYREEI 129
             .|.|.|         ....:.:|::.|.:..:|...::|..|..:....|..|.| .....|.:
Mouse   334 -GSVSLQ---------VPVSNEASNTASPHEEDSRSETASSGYASVQGADEPPLEEHAQSANENL 388

  Fly   130 EYLNQRIGALTV 141
            :.:|....::.|
Mouse   389 QLVNHEANSVAV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 15/41 (37%)
Rnf128NP_075759.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..428 11/59 (19%)
PA_GRAIL_like 48..193 CDD:239037
HRD1 <268..>368 CDD:227568 27/108 (25%)
RING-H2_RNF128-like 275..323 CDD:438454 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.