DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and Rnf130

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_067515.2 Gene:Rnf130 / 59044 MGIID:1891717 Length:419 Species:Mus musculus


Alignment Length:42 Identity:15/42 - (35%)
Similarity:26/42 - (61%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICR 49
            |.:|.|.::.:|.::...|.|.||:.|:|.|..:..|||:|:
Mouse   264 CAVCIESYKQNDVVRVLPCKHVFHKSCVDPWLSEHCTCPMCK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 14/40 (35%)
Rnf130NP_067515.2 PA_GRAIL_like 40..179 CDD:239037
HRD1 <197..>306 CDD:227568 15/42 (36%)
RING-H2_RNF130 262..310 CDD:319717 15/42 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.