DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and RNF150

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_005263207.1 Gene:RNF150 / 57484 HGNCID:23138 Length:460 Species:Homo sapiens


Alignment Length:174 Identity:37/174 - (21%)
Similarity:69/174 - (39%) Gaps:40/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYF----------QLYLDF 62
            |.:|.|.::.:|.::...|.|.||:.|:|.|....||||:|:.......          .|..||
Human   300 CAVCIEGYKPNDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKMNILKALGIPPNADCMDDLPTDF 364

  Fly    63 EEFPESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSSSDD----YIGIMREYE------- 116
            |          ||.||...:|...:|.::.       |::|.:.|    .:|.::..:       
Human   365 E----------GSLGGPPTNQITGASDTTV-------NESSVTLDPAVRTVGALQVVQDTDPIPQ 412

  Fly   117 --NLLYETGVYREEIEYLNQRIGALTVLNAELSKLHECSDSDVD 158
              ::::.|...:|.....:..|..:..:...||.:...:|.|.:
Human   413 EGDVIFTTNSEQEPAVSSDSDISLIMAMEVGLSDVELSTDQDCE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 15/40 (38%)
Prefoldin 112..>151 CDD:298833 5/47 (11%)
RNF150XP_005263207.1 PA_GRAIL_like 45..215 CDD:239037
UPF0233 <229..>254 CDD:299753
zf-RING_2 298..341 CDD:290367 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.