powered by:
Protein Alignment CG4325 and rnf130
DIOPT Version :9
Sequence 1: | NP_001259169.1 |
Gene: | CG4325 / 31167 |
FlyBaseID: | FBgn0026878 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009289393.1 |
Gene: | rnf130 / 553950 |
ZFINID: | ZDB-GENE-050522-525 |
Length: | 428 |
Species: | Danio rerio |
Alignment Length: | 42 |
Identity: | 15/42 - (35%) |
Similarity: | 26/42 - (61%) |
Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICR 49
|.:|.|.::.:|.::...|.|.||:.|:|.|..:..|||:|:
Zfish 273 CAVCIEGYQLNDVVRILPCKHVFHKMCVDPWLNEHCTCPMCK 314
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000832 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.