DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and traip

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001017318.1 Gene:traip / 550072 XenbaseID:XB-GENE-922321 Length:463 Species:Xenopus tropicalis


Alignment Length:46 Identity:23/46 - (50%)
Similarity:30/46 - (65%) Gaps:2/46 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQS--RTCPICRSQ 51
            |||||:.|..|.::.|.:|||.||::||..|...:  ||||.||.|
 Frog     7 CTICSDFFDNSRDVAAVTCGHTFHQECLLQWFHSAPHRTCPQCRIQ 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 20/42 (48%)
traipNP_001017318.1 RING-H2_TRAIP 6..50 CDD:438143 20/42 (48%)
EnvC 77..>312 CDD:443969
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.