powered by:
Protein Alignment CG4325 and traip
DIOPT Version :9
Sequence 1: | NP_001259169.1 |
Gene: | CG4325 / 31167 |
FlyBaseID: | FBgn0026878 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017318.1 |
Gene: | traip / 550072 |
XenbaseID: | XB-GENE-922321 |
Length: | 463 |
Species: | Xenopus tropicalis |
Alignment Length: | 46 |
Identity: | 23/46 - (50%) |
Similarity: | 30/46 - (65%) |
Gaps: | 2/46 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQS--RTCPICRSQ 51
|||||:.|..|.::.|.:|||.||::||..|...: ||||.||.|
Frog 7 CTICSDFFDNSRDVAAVTCGHTFHQECLLQWFHSAPHRTCPQCRIQ 52
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D581741at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR46569 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.110 |
|
Return to query results.
Submit another query.