DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and traip

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_991170.1 Gene:traip / 402900 ZFINID:ZDB-GENE-040801-30 Length:453 Species:Danio rerio


Alignment Length:67 Identity:27/67 - (40%)
Similarity:35/67 - (52%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQ--SRTCPICRSQ-DAAYFQLYLDFEEFPESA 69
            |||||:.|..|.::.|..|||.||..||..|.:.  ::|||.||.| ...:....|.|:..||..
Zfish     7 CTICSDFFDNSKDVAAIHCGHTFHYSCLLQWFQSAPNKTCPQCRKQVSTRHIINKLFFDIAPEDD 71

  Fly    70 SA 71
            .|
Zfish    72 GA 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 19/42 (45%)
Prefoldin 112..>151 CDD:298833
traipNP_991170.1 zf-RING_2 7..50 CDD:290367 19/42 (45%)
Prefoldin 136..256 CDD:298833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D581741at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46569
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.