powered by:
Protein Alignment CG4325 and traip
DIOPT Version :9
Sequence 1: | NP_001259169.1 |
Gene: | CG4325 / 31167 |
FlyBaseID: | FBgn0026878 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_991170.1 |
Gene: | traip / 402900 |
ZFINID: | ZDB-GENE-040801-30 |
Length: | 453 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 27/67 - (40%) |
Similarity: | 35/67 - (52%) |
Gaps: | 3/67 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQ--SRTCPICRSQ-DAAYFQLYLDFEEFPESA 69
|||||:.|..|.::.|..|||.||..||..|.:. ::|||.||.| ...:....|.|:..||..
Zfish 7 CTICSDFFDNSKDVAAIHCGHTFHYSCLLQWFQSAPNKTCPQCRKQVSTRHIINKLFFDIAPEDD 71
Fly 70 SA 71
.|
Zfish 72 GA 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D581741at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR46569 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.020 |
|
Return to query results.
Submit another query.