DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and traip

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_991170.1 Gene:traip / 402900 ZFINID:ZDB-GENE-040801-30 Length:453 Species:Danio rerio


Alignment Length:67 Identity:27/67 - (40%)
Similarity:35/67 - (52%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQ--SRTCPICRSQ-DAAYFQLYLDFEEFPESA 69
            |||||:.|..|.::.|..|||.||..||..|.:.  ::|||.||.| ...:....|.|:..||..
Zfish     7 CTICSDFFDNSKDVAAIHCGHTFHYSCLLQWFQSAPNKTCPQCRKQVSTRHIINKLFFDIAPEDD 71

  Fly    70 SA 71
            .|
Zfish    72 GA 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 19/42 (45%)
traipNP_991170.1 RING-H2_TRAIP 6..50 CDD:438143 19/42 (45%)
EnvC 72..>297 CDD:443969 1/2 (50%)

Return to query results.
Submit another query.