powered by:
Protein Alignment CG4325 and rnf181
DIOPT Version :9
Sequence 1: | NP_001259169.1 |
Gene: | CG4325 / 31167 |
FlyBaseID: | FBgn0026878 |
Length: | 158 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_956600.1 |
Gene: | rnf181 / 393276 |
ZFINID: | ZDB-GENE-040426-1024 |
Length: | 156 |
Species: | Danio rerio |
Alignment Length: | 63 |
Identity: | 20/63 - (31%) |
Similarity: | 32/63 - (50%) |
Gaps: | 9/63 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQ---DAAYFQLYLDFEEF 65
|.|.:|...|...::::...|.|.||..|:..|..::.:||:||.: |.| |:|||
Zfish 77 VKCPVCLLEFEEQESVREMPCKHLFHTGCILPWLNKTNSCPLCRLELPTDNA------DYEEF 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.