DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and nopo

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster


Alignment Length:59 Identity:24/59 - (40%)
Similarity:37/59 - (62%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAA--YFQLYLD 61
            |:.|.||:|.|..:|.:.|..|||.||.:||:.|..:|:|||.||::...  .|::|.:
  Fly     3 NLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYFN 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 19/41 (46%)
nopoNP_611305.1 RING-H2_TRAIP 5..47 CDD:438143 19/41 (46%)
SMC_N <75..>255 CDD:481474
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.