| Sequence 1: | NP_569969.1 | Gene: | CG4325 / 31167 | FlyBaseID: | FBgn0026878 | Length: | 158 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611305.1 | Gene: | nopo / 37083 | FlyBaseID: | FBgn0034314 | Length: | 435 | Species: | Drosophila melanogaster |
| Alignment Length: | 59 | Identity: | 24/59 - (40%) |
|---|---|---|---|
| Similarity: | 37/59 - (62%) | Gaps: | 2/59 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 NVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAA--YFQLYLD 61 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4325 | NP_569969.1 | RING-H2_TRAIP | 7..49 | CDD:438143 | 19/41 (46%) |
| nopo | NP_611305.1 | RING-H2_TRAIP | 5..47 | CDD:438143 | 19/41 (46%) |
| SMC_N | <75..>255 | CDD:481474 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||