DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and CG10916

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001261070.1 Gene:CG10916 / 37081 FlyBaseID:FBgn0034312 Length:263 Species:Drosophila melanogaster


Alignment Length:66 Identity:33/66 - (50%)
Similarity:42/66 - (63%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NVICTICSERFRTSDNIQAGS-CGHAFHEDCLDHWRKQSRTCPICRS--QDAAYFQLYLDFEEFP 66
            |::|.||:|.||.:|.|.:.| |||.||:|||..|..:|||||.||.  ......:|||:|.|.|
  Fly    29 NILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYLNFAEAP 93

  Fly    67 E 67
            |
  Fly    94 E 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 23/41 (56%)
Prefoldin 112..>151 CDD:298833
CG10916NP_001261070.1 zf-RING_2 32..74 CDD:290367 23/41 (56%)
zf-rbx1 <32..74 CDD:289448 23/41 (56%)
DM9 105..183 CDD:128937
DUF3421 133..246 CDD:288732
DM9 186..254 CDD:128937
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11352
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103393at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.