DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and Traip

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001102474.1 Gene:Traip / 367167 RGDID:1309761 Length:469 Species:Rattus norvegicus


Alignment Length:67 Identity:28/67 - (41%)
Similarity:35/67 - (52%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICTICSERFRTSDNIQAGSCGHAFHEDCLDHW--RKQSRTCPICRSQ---DAAYFQLYLDFEEFP 66
            :|||||:.|..|.::.|..|||.||..||..|  ...|||||.||.|   .....:|:.|..:..
  Rat     6 LCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKKTIINKLFFDLAQEE 70

  Fly    67 ES 68
            ||
  Rat    71 ES 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 21/43 (49%)
TraipNP_001102474.1 RING-H2_TRAIP 6..50 CDD:438143 21/43 (49%)
EnvC 65..>279 CDD:443969 3/8 (38%)

Return to query results.
Submit another query.