DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and Rnf150

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001178022.1 Gene:Rnf150 / 364983 RGDID:1304572 Length:437 Species:Rattus norvegicus


Alignment Length:174 Identity:39/174 - (22%)
Similarity:69/174 - (39%) Gaps:40/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYF----------QLYLDF 62
            |.:|.|.::.||.::...|.|.||:.|:|.|....||||:|:.......          .|.:||
  Rat   277 CAVCIEGYKPSDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKMNILKALGIPPNADCMDDLPIDF 341

  Fly    63 EEFPESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSSSDD----YIGIMREYEN------ 117
            |          ||.||...:|...:|.::.       |::|.:.|    .:|.::..::      
  Rat   342 E----------GSLGGPPTNQITGASDTTV-------NESSVTLDPAVRTVGALQVVQDPDPAPQ 389

  Fly   118 ---LLYETGVYREEIEYLNQRIGALTVLNAELSKLHECSDSDVD 158
               .::.|...:|.....:..|..:..|...||.:...:|.|.:
  Rat   390 EGEAIFTTNSDQEPAVSSDSDISLIMALEVGLSDVELSTDQDCE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 16/40 (40%)
Rnf150NP_001178022.1 PA_GRAIL_like 45..192 CDD:239037
RING-H2_RNF150 269..323 CDD:438456 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.