DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and Rnf149

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_017452282.1 Gene:Rnf149 / 363222 RGDID:1308460 Length:394 Species:Rattus norvegicus


Alignment Length:95 Identity:30/95 - (31%)
Similarity:44/95 - (46%) Gaps:11/95 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICR---SQDAAYFQLYLDFEEFPESA 69
            |.:|.|.|:..|.|:...|.|.||..|:|.|....||||:|:   .:...|:....|.::.|...
  Rat   265 CAVCIENFKVKDVIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGDPEDAQDLPIPE 329

  Fly    70 SAQGGSWGGH--------NRSQGHSSSSSS 91
            :|.|....|:        .||:.:..||||
  Rat   330 AAPGSVSVGNLSVTVQDEERSESNLPSSSS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 17/40 (43%)
Prefoldin 112..>151 CDD:298833
Rnf149XP_017452282.1 PA_GRAIL_like 45..181 CDD:239037
UPF0233 <200..>220 CDD:299753
zf-RING_2 263..306 CDD:290367 17/40 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.