DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and AT3G51325

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_974410.1 Gene:AT3G51325 / 2745959 AraportID:AT3G51325 Length:90 Species:Arabidopsis thaliana


Alignment Length:69 Identity:24/69 - (34%)
Similarity:31/69 - (44%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GRNNVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSR--TCPICRSQDAAYF---QLYLD 61
            ||....|::|..|....|.|::..|.|.||..|:|.|...||  .||:||.......   :|.|.
plant    20 GREEECCSVCLMRMEAKDVIKSLPCSHEFHSLCVDTWFNVSRKICCPLCRFSPTTILLTDELLLW 84

  Fly    62 FEEF 65
            |..|
plant    85 FSSF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 16/43 (37%)
AT3G51325NP_974410.1 RING_Ubox 17..76 CDD:473075 20/55 (36%)

Return to query results.
Submit another query.