DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and Ttc3

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_006523047.1 Gene:Ttc3 / 22129 MGIID:1276539 Length:1998 Species:Mus musculus


Alignment Length:45 Identity:21/45 - (46%)
Similarity:25/45 - (55%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQD 52
            |.||.|.|: |.|::...|||.||:.|...|.|...|||.|.|.|
Mouse  1950 CEICHEIFK-SKNMRVLKCGHKFHKGCFKQWLKGQSTCPTCGSSD 1993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 18/40 (45%)
Prefoldin 112..>151 CDD:298833
Ttc3XP_006523047.1 TPR repeat 251..278 CDD:276809
PLN03088 256..>400 CDD:215568
TPR repeat 283..313 CDD:276809
TPR repeat 318..346 CDD:276809
TPR repeat 510..537 CDD:276809
TPR repeat 554..587 CDD:276809
TPR repeat 595..621 CDD:276809
TPR_1 597..624 CDD:366144
PTZ00121 <1479..1713 CDD:173412
RING-H2_TTC3 1949..1989 CDD:319395 18/39 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7158
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.