DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and Traip

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_035764.2 Gene:Traip / 22036 MGIID:1096377 Length:470 Species:Mus musculus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:60/155 - (38%) Gaps:41/155 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICTICSERFRTSDNIQAGSCGHAFHEDCLDHW--RKQSRTCPICRSQ-------DAAYFQLYLDF 62
            :|||||:.|..|.::.|..|||.||..||..|  ...|||||.||.|       :..:|.|..:.
Mouse     6 LCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKKTIINKLFFDLAQEE 70

  Fly    63 E-----EFPESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSSSDDYIGIMREYENLLYET 122
            |     ||.::..               .|..:..|..:....|:.:..|.:....|..|...|:
Mouse    71 ENVLDAEFLKNEL---------------DSVKAQLSQKDREKRDSQAIIDTLRDTLEERNATVES 120

  Fly   123 ------------GVYREEIEYLNQR 135
                        ...::::::|.||
Mouse   121 LQNALNKAEMLCSTLKKQMKFLEQR 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 21/43 (49%)
TraipNP_035764.2 RING-H2_TRAIP 6..50 CDD:438143 21/43 (49%)
EnvC 65..>279 CDD:443969 14/96 (15%)
Interaction with CYLD. /evidence=ECO:0000250|UniProtKB:Q9BWF2 211..470
PIP-box. /evidence=ECO:0000250|UniProtKB:Q9BWF2 461..470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.