DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and Traip

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_035764.2 Gene:Traip / 22036 MGIID:1096377 Length:470 Species:Mus musculus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:60/155 - (38%) Gaps:41/155 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICTICSERFRTSDNIQAGSCGHAFHEDCLDHW--RKQSRTCPICRSQ-------DAAYFQLYLDF 62
            :|||||:.|..|.::.|..|||.||..||..|  ...|||||.||.|       :..:|.|..:.
Mouse     6 LCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKKTIINKLFFDLAQEE 70

  Fly    63 E-----EFPESASAQGGSWGGHNRSQGHSSSSSSCSSNNNNSNDNSSSDDYIGIMREYENLLYET 122
            |     ||.::..               .|..:..|..:....|:.:..|.:....|..|...|:
Mouse    71 ENVLDAEFLKNEL---------------DSVKAQLSQKDREKRDSQAIIDTLRDTLEERNATVES 120

  Fly   123 ------------GVYREEIEYLNQR 135
                        ...::::::|.||
Mouse   121 LQNALNKAEMLCSTLKKQMKFLEQR 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 21/42 (50%)
Prefoldin 112..>151 CDD:298833 6/36 (17%)
TraipNP_035764.2 zf-RING_2 7..50 CDD:290367 21/42 (50%)
BRE1 204..>271 CDD:285810
Interaction with CYLD. /evidence=ECO:0000250|UniProtKB:Q9BWF2 211..470
PIP-box. /evidence=ECO:0000250|UniProtKB:Q9BWF2 461..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11289
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46569
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.