DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and C01G6.4

DIOPT Version :10

Sequence 1:NP_569969.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001379057.1 Gene:C01G6.4 / 182077 WormBaseID:WBGene00007226 Length:170 Species:Caenorhabditis elegans


Alignment Length:41 Identity:17/41 - (41%)
Similarity:24/41 - (58%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPIC 48
            |.||...|...:.|:...|.|:||::|:|.|..:|.|||.|
 Worm    95 CAICMIDFEPGERIRFLPCMHSFHQECVDEWLMKSFTCPSC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_569969.1 RING-H2_TRAIP 7..49 CDD:438143 17/41 (41%)
C01G6.4NP_001379057.1 RING-H2_RNF11 94..136 CDD:438131 17/41 (41%)

Return to query results.
Submit another query.