DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and trul-1

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001370339.1 Gene:trul-1 / 173412 WormBaseID:WBGene00015194 Length:451 Species:Caenorhabditis elegans


Alignment Length:162 Identity:40/162 - (24%)
Similarity:64/162 - (39%) Gaps:39/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICR---SQDAAYFQLYLDFEEFPESA 69
            |:||.|..:.:|.|.|..|||.:|..|:..|....|.||.||   .::....:|:.|.:..    
 Worm    13 CSICFEDLKQNDKISAIVCGHIYHHGCISQWIATKRQCPSCRRTVPKNGFVEKLFFDVQRM---- 73

  Fly    70 SAQGGSWGGH--------NRSQGHSSSSS---------SCSSNNNNSNDNSSSDDYIGIMREYEN 117
                   ||.        .|.:.:..|:|         :.::.|.|..|...|.:        :.
 Worm    74 -------GGEAEKPPEIDYREEHYKLSTSLKVEQEKLGTLNTENKNLKDTVKSLE--------KK 123

  Fly   118 LLYETGVYREEIEYLNQRIGALTVLNAELSKL 149
            ::.|...||:||..|...|..||:.:.|.:.|
 Worm   124 IIREKDKYRQEIPKLQATINHLTISSEETAYL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 16/40 (40%)
Prefoldin 112..>151 CDD:298833 11/38 (29%)
trul-1NP_001370339.1 RING-H2_TTC3 12..54 CDD:319395 16/40 (40%)
SMC_prok_A <84..>261 CDD:274009 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D581741at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46569
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.