DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4325 and pja2

DIOPT Version :9

Sequence 1:NP_001259169.1 Gene:CG4325 / 31167 FlyBaseID:FBgn0026878 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_004910519.4 Gene:pja2 / 100379719 XenbaseID:XB-GENE-966471 Length:727 Species:Xenopus tropicalis


Alignment Length:81 Identity:25/81 - (30%)
Similarity:36/81 - (44%) Gaps:11/81 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NNVI-----CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICR------SQDAAYFQ 57
            :|::     |.||...:...:.:....|.|.||:.|:..|.::|.|||:||      ..|||...
 Frog   645 HNIVGQEQCCAICCSEYIKDEILTELPCHHLFHKPCVTLWLQKSGTCPVCRHVLASSHTDAAATS 709

  Fly    58 LYLDFEEFPESASAQG 73
            ...|.|..|...||.|
 Frog   710 FLSDHESPPSIHSAAG 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4325NP_001259169.1 zf-RING_2 8..49 CDD:290367 13/40 (33%)
Prefoldin 112..>151 CDD:298833
pja2XP_004910519.4 RING-H2_PJA1_2 653..698 CDD:319379 15/44 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.