DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actn and AT2G04750

DIOPT Version :9

Sequence 1:NP_001259165.1 Gene:Actn / 31166 FlyBaseID:FBgn0000667 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_178552.1 Gene:AT2G04750 / 815018 AraportID:AT2G04750 Length:652 Species:Arabidopsis thaliana


Alignment Length:255 Identity:70/255 - (27%)
Similarity:115/255 - (45%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NGLSMEYGD------GYMEQEEEWEREGLLDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFR 63
            ||||.|...      ..:.::||..||           ::.|..|.||  ..|.|.:||:.||.|
plant   364 NGLSDESPKVPISVAEMVTEDEETSRE-----------ERCFRHWMNS--LGAVTYVDNVFEDVR 415

  Fly    64 NGLKLMLLLEVISGETL-----PKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNL 123
            ||..|:.:|:.:|..::     .||.. ||.|.|:.|.|:.:.........||::...:|:.||.
plant   416 NGWVLLEVLDKVSPGSVNWKHANKPPI-KMPFKKVENCNQVIKIGKELNFSLVNVAGHDIMQGNK 479

  Fly   124 KMTLGMIWTIILRFAIQDI--------SVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKD-- 178
            |:.|..:|. ::|:.:..|        ..:::|..: :|.|..||.   |.....:..:||||  
plant   480 KLLLAFLWQ-LMRYTMLQILNNLRSHCQGKDITEAD-ILNWANRKV---KKSGRTSQAVSFKDKN 539

  Fly   179 ---GLAFCALIHRHRPDLIDYAKLSKDNPLE--NLNTAF--DVAEKYLDIPRMLDPDDLI 231
               |:.|..|:....|.:::::.:||....|  |||..:  .||.| |.....|.|:|::
plant   540 LANGIFFLELLSAVEPRVVNWSLVSKGETQEEKNLNATYIISVARK-LGCSIFLLPEDIL 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActnNP_001259165.1 CH_ACTN_rpt1 31..135 CDD:409063 32/108 (30%)
CH_ACTN_rpt2 139..252 CDD:409065 28/110 (25%)
SPEC 302..525 CDD:238103
SPEC 420..647 CDD:238103
SPEC 538..760 CDD:238103
EFh 775..842 CDD:238008
EFhand_Ca_insen 847..913 CDD:400872
AT2G04750NP_178552.1 SAC6 112..607 CDD:227401 70/255 (27%)
CH_AtFIM_like_rpt1 117..232 CDD:409142
CH_AtFIM_like_rpt3 386..499 CDD:409148 37/127 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.