DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actn and MICALL2

DIOPT Version :10

Sequence 1:NP_477485.1 Gene:Actn / 31166 FlyBaseID:FBgn0000667 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_891554.1 Gene:MICALL2 / 79778 HGNCID:29672 Length:904 Species:Homo sapiens


Alignment Length:223 Identity:72/223 - (32%)
Similarity:105/223 - (47%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 MTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTA 211
            |.|...|..||:::...|::||:.|...||:|||||||::||||||||:::.|.|:|..||...|
Human     1 MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENNKLA 65

  Fly   212 FDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQVGNVTHVPEPTRQYTYVPN 276
            |.|||::|.||.:||.:|::....||..:|:||||.||:.|.|...:|.:..|...:......|:
Human    66 FRVAEEHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKRASEDSEEEPS 130

  Fly   277 NYNAETAANRICK-------VLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAG- 333
            ...|...|.::..       .|...|.|..:....|.....             ..:.|.:||| 
Human   131 GKKAPVQAAKLPSPAPARKPPLSPAQTNPVVQRRNEGAGGP-------------PPKTDQALAGS 182

  Fly   334 ---------------VQKKLEEYRTYRR 346
                           ||:.|.:.|.|.|
Human   183 LVSSTCGVCGKHVHLVQRHLADGRLYHR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActnNP_477485.1 CH_ACTN_rpt1 31..135 CDD:409063
CH_ACTN_rpt2 139..252 CDD:409065 51/104 (49%)
SPEC 302..525 CDD:238103 11/61 (18%)
SPEC 420..647 CDD:238103
SPEC 538..760 CDD:238103
EFh 775..842 CDD:238008
EFhand_Ca_insen 847..913 CDD:430177
MICALL2NP_891554.1 Forms an intramolecular interaction with the C-terminal coiled coil domain keeping the protein in a closed conformation. /evidence=ECO:0000250 1..260 72/223 (32%)
CH_MICALL2 2..107 CDD:409102 50/104 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..178 9/73 (12%)
LIM_Mical_like_1 188..241 CDD:188828 6/23 (26%)
PHA03247 <243..649 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..722
Mediates targeting to the cell plasma membrane. /evidence=ECO:0000250 261..697
Necessary and sufficient for interaction with actinins. /evidence=ECO:0000250 261..388
Forms an intramolecular interaction with the N-terminal Calponin-homology and LIM zinc-binding domains-containing region keeping the protein in a closed conformation. /evidence=ECO:0000250 698..807
bMERB_dom 743..872 CDD:463467
Mediates interaction with RAB13 and is required for transition from the closed to the opened conformation. /evidence=ECO:0000250 807..903
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.