DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actn and jbug

DIOPT Version :9

Sequence 1:NP_001259165.1 Gene:Actn / 31166 FlyBaseID:FBgn0000667 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_001261140.1 Gene:jbug / 43997 FlyBaseID:FBgn0028371 Length:2990 Species:Drosophila melanogaster


Alignment Length:270 Identity:76/270 - (28%)
Similarity:132/270 - (48%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLP-KPD---RGKMRFHK 92
            |.:.|..||..|.|.|||:.|..:.:...||.:|..|..|:|.:  :|.| ||.   |...:.|.
  Fly    57 WVEIQANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENL--QTRPLKPSWNRRPANQHHY 119

  Fly    93 IANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWC 157
            :.|...||..|.:..:.||:||..:||:||:|:.||:||::|:|:   .|...:...::.:|.|.
  Fly   120 LENATTALKSIEADHIKLVNIGNVDIVNGNIKLILGLIWSLIVRY---QIGRSKFPPRKLMLAWL 181

  Fly   158 QRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLI-DYAKLSKDNPLENLNTAFDVAEKYLDI 221
            |   |...:..:.|....:..|:...||:...:|.|. .:..|.....:.|...|.|:|::...:
  Fly   182 Q---AALPDCRITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTQAMDLAQREFGV 243

  Fly   222 PRMLDPDDLINTPKPDERAIMTYVSCYYH----AFQGAQQVGNVTHVPEPTRQYTYVPNNYNAET 282
            |::|:|:.|. :|..||.:.|||:|.:..    .:....:..| |.|.:|.:.:|...|:     
  Fly   244 PKVLEPEYLA-SPWLDELSGMTYLSYFMKPGGPGYNATMRWVN-TQVKDPVKNFTTDWND----- 301

  Fly   283 AANRICKVLK 292
             ...:|:::|
  Fly   302 -GRVMCEIIK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActnNP_001259165.1 CH_ACTN_rpt1 31..135 CDD:409063 39/106 (37%)
CH_ACTN_rpt2 139..252 CDD:409065 27/117 (23%)
SPEC 302..525 CDD:238103
SPEC 420..647 CDD:238103
SPEC 538..760 CDD:238103
EFh 775..842 CDD:238008
EFhand_Ca_insen 847..913 CDD:400872
jbugNP_001261140.1 CH 60..165 CDD:237981 40/109 (37%)
CH 172..269 CDD:278723 26/100 (26%)
CH 281..371 CDD:278723 8/37 (22%)
IG_FLMN 468..560 CDD:214720
Filamin 468..554 CDD:279024
Filamin 557..644 CDD:279024
IG_FLMN 560..648 CDD:214720
Filamin 1116..1200 CDD:279024
IG_FLMN 1119..1198 CDD:214720
Filamin 1210..1294 CDD:279024
Filamin 1299..1383 CDD:279024
IG_FLMN 1310..1389 CDD:214720
Filamin 1386..1473 CDD:279024
IG_FLMN 1399..1480 CDD:214720
Filamin 1477..1563 CDD:279024
IG_FLMN 1480..1569 CDD:214720
Filamin 1570..1653 CDD:279024
IG_FLMN 1575..1659 CDD:214720
Filamin 1657..1741 CDD:279024
IG_FLMN 1661..1747 CDD:214720
Filamin 1756..1830 CDD:279024
Filamin 1834..1919 CDD:279024
IG_FLMN 1837..1926 CDD:214720
IG_FLMN 1936..2023 CDD:214720
Filamin 1941..2017 CDD:279024
Filamin 2021..2111 CDD:279024
IG_FLMN 2025..2114 CDD:214720
Filamin 2187..2268 CDD:279024
Filamin 2279..2369 CDD:279024
IG_FLMN 2285..2375 CDD:214720
Filamin 2372..2459 CDD:279024
IG_FLMN 2376..2465 CDD:214720
IG_FLMN 2474..2561 CDD:214720
Filamin 2474..2555 CDD:279024
IG_FLMN 2657..2751 CDD:214720
Filamin 2657..2745 CDD:279024
Filamin 2755..2840 CDD:279024
IG_FLMN 2756..2847 CDD:214720
Filamin 2847..2937 CDD:279024
IG_FLMN 2850..2944 CDD:214720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.