DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Actn and LOC110440135

DIOPT Version :9

Sequence 1:	NP_001259165.1	Gene:	Actn / 31166	FlyBaseID:	FBgn0000667	Length:	917	Species:	Drosophila melanogaster
Sequence 2:	XP_021335869.1	Gene:	LOC110440135 / 110440135	-ID:	-	Length:	137	Species:	Danio rerio

Alignment Length:	133	Identity:	85/133 - (63%)
Similarity:	110/133 - (82%)	Gaps:	5/133 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   785 KNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTD 849
            :.:.|.:..::|::||:|:||.:     |:.:|.||:|:||||.:|.|.|.||:||||||:.::|
Zfish    10 QKKKGGMETDDFRACLISMGYDL-----GEAEFARIMALVDPNGSGVVTFQAFVDFMTRETGESD 69

  Fly   850 TAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGE 914
            |:|||:.|||||||||||||.|||||||||:||||||.||||||||:.|||||||.:||||||||
Zfish    70 TSEQVVASFRILAADKPYILVDELRRELPPEQAEYCISRMPPYKGPDAVPGALDYAAFSTALYGE 134

  Fly   915 TDL 917
            :||
Zfish   135 SDL 137

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Actn	NP_001259165.1	CH_ACTN_rpt1	31..135	CDD:409063
		CH_ACTN_rpt2	139..252	CDD:409065
		SPEC	302..525	CDD:238103
		SPEC	420..647	CDD:238103
		SPEC	538..760	CDD:238103
		EFh	775..842	CDD:238008	23/56 (41%)
		EFhand_Ca_insen	847..913	CDD:400872	53/65 (82%)
LOC110440135	XP_021335869.1	EFh	<14..62	CDD:238008	23/52 (44%)
LOC110440135	XP_021335869.1	EFhand_Ca_insen	67..133	CDD:312305	53/65 (82%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D543832at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010