DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment usp and NR2C2

DIOPT Version :9

Sequence 1:NP_001259168.1 Gene:usp / 31165 FlyBaseID:FBgn0003964 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_011532360.1 Gene:NR2C2 / 7182 HGNCID:7972 Length:648 Species:Homo sapiens


Alignment Length:501 Identity:141/501 - (28%)
Similarity:199/501 - (39%) Gaps:182/501 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLTCG 168
            |.:|||:|||:|||..|||||||||||:|||:|||:||.|::|||:|..|||||:||.:|||..|
Human   169 CVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEMG 233

  Fly   169 MKREAVQEER-----QR----------------------------------GAR----------- 183
            ||.|:||.||     ||                                  |||           
Human   234 MKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLLDPGMLV 298

  Fly   184 -------------------------NAAGRL------------SASGG----------------- 194
                                     .|.|.|            |.:.|                 
Human   299 NIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITR 363

  Fly   195 -------------GSSGPGSVGGSSSQGGGGGGGVSGGMGSGNGSDDFMTNSVSRDFSIERIIEA 246
                         .||.|....|..:.|||.                  .:.:|||.|.. |||.
Human   364 AFDTLAKALNTTDSSSSPSLADGIDTSGGGS------------------IHVISRDQSTP-IIEV 409

  Fly   247 EQRAETQCGDRALTFLRVGPYSTVQPDYKGAVSALCQVVNKQLFQMVEYARMMPHFAQVPLDDQV 311
            |   .....|..:||....|  :..|:|.. |..:|:..::.||..:.:||.:|.|..:..|...
Human   410 E---GPLLSDTHVTFKLTMP--SPMPEYLN-VHYICESASRLLFLSMHWARSIPAFQALGQDCNT 468

  Fly   312 ILLKAAWIELLIANVAWCS-IVSLDDGGAGGGGGGLGHDGSFERRSPGLQPQQLFLNQSFSYHRN 375
            .|::|.|.||....:|.|: ::||                            ...|....::.:|
Human   469 SLVRACWNELFTLGLAQCAQVMSL----------------------------STILAAIVNHLQN 505

  Fly   376 SAIKAGVSAIFDRI---------LSELSVKMKRLNLDRRELSCLKAIILYNPDIRGIKSRAEIEM 431
            |..:..:|.  |||         |.|....|.:|::|..|.:.||||:|::||..|:.|.::||.
Human   506 SIQEDKLSG--DRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEK 568

  Fly   432 CREKVYACLDEHCRLEHPGDDGRFAQLLLRLPALRSISLKCQDHLF 477
            .:||....|.::.:..:..|..|.|::|:||||||.:|....:.||
Human   569 FQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELF 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
uspNP_001259168.1 NR_DBD_RXR 102..178 CDD:143514 50/73 (68%)
NR_LBD_RXR_like 237..480 CDD:132741 70/251 (28%)
NR2C2XP_011532360.1 NR_DBD_TR2_like 164..250 CDD:143525 52/80 (65%)
NR_LBD_TR2_like 413..634 CDD:132750 64/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.