DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment usp and Hr83

DIOPT Version :9

Sequence 1:NP_001259168.1 Gene:usp / 31165 FlyBaseID:FBgn0003964 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_649647.1 Gene:Hr83 / 40783 FlyBaseID:FBgn0037436 Length:278 Species:Drosophila melanogaster


Alignment Length:380 Identity:94/380 - (24%)
Similarity:136/380 - (35%) Gaps:141/380 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYAC-RENRNCIIDKRQRNRCQYCRYQKCLTC 167
            |::|||::|||||||..|:||..||||:||:..:||| ....||::||.:||.|..||:|:||..
  Fly     7 CAVCGDQSSGKHYGVSCCDGCSCFFKRSVRRGSSYACIALVGNCVVDKARRNWCPSCRFQRCLAV 71

  Fly   168 GMKREAVQEERQRGARNAAGRLSASGGGSSGPGSVGGSSSQGGGGGGGVSGGMGSGNGSDDFMTN 232
            ||...|||||  ||.||....|..:|...:.|.....|.:.                        
  Fly    72 GMNAAAVQEE--RGPRNQQVALYRTGRRQAPPSQAAPSPTP------------------------ 110

  Fly   233 SVSRDFSIERIIEAEQRAETQCGDRALTFLRVGPYSTVQPDYKGAVSALCQVVNKQLFQMVEYAR 297
                                  ..:||.|                     |::.:.|...:..|:
  Fly   111 ----------------------HSQALHF---------------------QILAQILVTCLRQAK 132

  Fly   298 MMPHFAQVPLDDQVILLKAAWIELLIANVA-WCSIVSLDDGGAGGGGGGLGHDGSFERRSPGLQP 361
            ....||.:....|..:.:..|.|:.:...: |    |||                          
  Fly   133 ANEQFALLDRCQQDAIFQVVWSEIFVLRASHW----SLD-------------------------- 167

  Fly   362 QQLFLNQSFSYHRNSAIKAGVSAIFDRILSELSVKMKRLNLDRRELSCLKAIILYNPD------- 419
                            |.|.:....|..|..|..:..:|..|..||:.::::||...:       
  Fly   168 ----------------ISAMIDGCGDEQLKRLICEAHQLRADVLELNFMESLILCRKELAINAEY 216

  Fly   420 --IRGIKSRAE-IEMCREKVYACLDEHCRLEHPGDDGRFAQLLLRLPALRSISLK 471
              |.|..|:|. |.:.|   |. |.:...|       ||.||||   .||.:.|:
  Fly   217 AVILGSHSKAALISLAR---YT-LQQSNYL-------RFGQLLL---GLRQLCLR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
uspNP_001259168.1 NR_DBD_RXR 102..178 CDD:143514 41/74 (55%)
NR_LBD_RXR_like 237..480 CDD:132741 44/246 (18%)
Hr83NP_649647.1 NR_DBD_PNR_like_2 7..88 CDD:143515 46/82 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444772
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.