DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment usp and Nr2c1

DIOPT Version :9

Sequence 1:NP_001259168.1 Gene:usp / 31165 FlyBaseID:FBgn0003964 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_665723.1 Gene:Nr2c1 / 252924 RGDID:3200 Length:590 Species:Rattus norvegicus


Alignment Length:525 Identity:138/525 - (26%)
Similarity:214/525 - (40%) Gaps:153/525 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 NHPLSGSK---HLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNR 155
            |.|..|..   .||.:|||:|||:|||..:||||||||||::||:|.|:||.:::|||:|..|||
  Rat    88 NSPDQGPNKVFDLCVVCGDKASGRHYGAITCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNR 152

  Fly   156 CQYCRYQKCLTCGMKREAVQEERQ--RGARNAAGRLSAS-------------------------- 192
            |||||.|:|:..|||:::||.||:  ..:|..:...:||                          
  Rat   153 CQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSET 217

  Fly   193 ----GGGSSG------PGSV-----------GGSSSQGGGG---------------------GGG 215
                |...||      |..:           ...|.||..|                     ||.
  Rat   218 ARSTGLLDSGMFVNIHPSGIKTEPALLMTPDKAESCQGDLGTLASVVTSLANLGKAKDLSHCGGD 282

  Fly   216 V-------SGGMGSGNGSDDFMTN-SVSRDF--------------------SIE---RIIEAE-- 247
            :       :|....|....|..|| .|||.|                    |:|   .:|..|  
  Rat   283 LPVVQSLRNGDTSFGAFHQDIQTNGDVSRAFDNLAKALTPGENPACQSPGESMEGSTHLIAGEPS 347

  Fly   248 --QRAETQCGDRALTFLRVGPYSTVQPDYKGAVSALCQVVNKQLFQMVEYARMMPHFAQVPLDDQ 310
              :|......|..:.|....|  :..|:|.. |..:.:..::.||..:.:|..:|.|..:..::.
  Rat   348 CMEREGPLLSDSHVVFRLTMP--SPMPEYLN-VHYIGESASRLLFLSMHWALSIPSFQALGQENS 409

  Fly   311 VILLKAAWIELLIANVAWC-----------SIVSLDDGGAGGGGGGLGHDGSFERRSPGLQPQQL 364
            :.|:||.|.||....:|.|           :.|:.           |.:....::.||  :.::|
  Rat   410 ISLVKAYWNELFTLGLAQCWQVMNVATILATFVNC-----------LHNSLQQDKMSP--ERRKL 461

  Fly   365 FLNQSFSYHRNSAIKAGVSAIFDRILSELSVKMKRLNLDRRELSCLKAIILYNPDIRGIKSRAEI 429
            .:...|.                  |.|....|.:|.:|..|.:.||||:|::||..|:::...|
  Rat   462 LMEHIFK------------------LQEFCNSMVKLCIDGHEYAYLKAIVLFSPDHPGLENMELI 508

  Fly   430 EMCREKVYACLDEHCRLEHPGDDGRFAQLLLRLPALRSISLKCQDHLFLFRITSDRPLEELFLEQ 494
            |..:||.|....::....:|.|..|.::|||||||||.::....:.||...:..:..::.:....
  Rat   509 EKFQEKAYVEFQDYITRTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHI 573

  Fly   495 LEAPP 499
            |:..|
  Rat   574 LKMEP 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
uspNP_001259168.1 NR_DBD_RXR 102..178 CDD:143514 46/75 (61%)
NR_LBD_RXR_like 237..480 CDD:132741 64/280 (23%)
Nr2c1NP_665723.1 Required for interaction with KAT2B. /evidence=ECO:0000250 1..166 44/77 (57%)
NR_DBD_TR2_like 96..182 CDD:143525 48/85 (56%)
NR_LBD_TR2_like 355..576 CDD:132750 59/254 (23%)
Required for interaction with NRIP1. /evidence=ECO:0000250 571..590 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.