DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment usp and nhr-149

DIOPT Version :9

Sequence 1:NP_001259168.1 Gene:usp / 31165 FlyBaseID:FBgn0003964 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_504874.2 Gene:nhr-149 / 182174 WormBaseID:WBGene00015397 Length:375 Species:Caenorhabditis elegans


Alignment Length:412 Identity:88/412 - (21%)
Similarity:144/412 - (34%) Gaps:137/412 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRN----RCQYCRYQ 162
            ||||||...|.|.||.|.||:|||.||:|.....:...|..|..|....|:.|    :|:.||:|
 Worm     5 HLCSICSRPAQGYHYDVISCKGCKTFFRRMWLSKIKEMCPLNNKCFDFNRRINMSLSKCRACRFQ 69

  Fly   163 KCLTCGMKREAVQEERQRGARNAAGRLSASGGGSSGPGSVGGSSSQGGGGGGGVSGGMGSGNGSD 227
            :||..||...|:|.:                                             ||...
 Worm    70 RCLNVGMNPAAIQCD---------------------------------------------GNPKK 89

  Fly   228 DFMTNSVSRDF-----SIERIIEAEQRAETQC-----------------------GDRALTFLRV 264
            |   :|..|||     .|:.||:.....|.:.                       |..:|:...:
 Worm    90 D---SSHFRDFDSIDEKIKNIIDTLTYVELKLENYRKSAYNPVLSLSTGLDDLIEGSCSLSLAEI 151

  Fly   265 -GPYSTVQ---PDYKGAVSAL--------CQVVNKQ------LFQMVEYARMMPHFAQVPLDDQV 311
             ||.|...   .:::...|::        |.|.|::      :...:||.:....|.::...|:.
 Worm   152 YGPMSGWPLGFEEHQLPSSSMRNVSCEEPCPVSNRKYWTHCNMLTTIEYFKTFKFFHELSSRDKF 216

  Fly   312 ILLKAAWIELLIANVAWCSIVSLDDGGAGGGGGGLGHDGSFERRSPGLQPQQLFLNQSFSYHRNS 376
            :|.:...:.....:::..::....|       ..|..|||       :||:|        ..|:.
 Worm   217 VLARHTLLLCQNLHISHYTVSHNFD-------SCLQPDGS-------MQPKQ--------DERHY 259

  Fly   377 AIKAGVSAIFDRILSELSVK-MKRLNLDRRELSCLKAIILYNPDIRGIKSRAEIEMCREKVYACL 440
            .|            :.:|:: :.|..:...|...||||...||.:..:...|:..:.:|: |...
 Worm   260 PI------------AMMSIEPLVRCKIQHVEYVLLKAICFCNPAVPELSQNAQRILAKER-YCFA 311

  Fly   441 D---EHCRLEHPGDDGRFAQLL 459
            |   .||...:....|.||:|:
 Worm   312 DILINHCLRNYTDGPGHFAELI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
uspNP_001259168.1 NR_DBD_RXR 102..178 CDD:143514 34/79 (43%)
NR_LBD_RXR_like 237..480 CDD:132741 49/273 (18%)
nhr-149NP_504874.2 ZnF_C4 6..78 CDD:197701 31/71 (44%)
HOLI 190..342 CDD:214658 34/179 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.