DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stk4 and Pak

DIOPT Version :9

Sequence 1:NP_001101270.1 Gene:Stk4 / 311622 RGDID:1312035 Length:487 Species:Rattus norvegicus
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:307 Identity:125/307 - (40%)
Similarity:185/307 - (60%) Gaps:12/307 - (3%)


- Green bases have known domain annotations that are detailed below.


  Rat     3 TVQLRNPPRRQLKKLDEDSLTK--------QPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIK 59
            |...|....::.|..||:.|.|        .|...:..:||:|:|:.|:||.||...||..||||
  Fly   531 TPNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIK 595

  Rat    60 QVPVESDLQE--IIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLT 122
            |:.:....::  ||.||.:|::...|:||.|..||..:.:||:||||...||::|::  ....:.
  Fly   596 QMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV--TETCMD 658

  Rat   123 EDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGT 187
            |.:||.:.:..|:.||:||..:.||||||:.||||..:|..||.|||...|::...:||.|::||
  Fly   659 EGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGT 723

  Rat   188 PFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEVWSD 252
            |:||||||:....|....|:|||||.||||.||:|||.:.:|::|:::|.||..|..::.:..|.
  Fly   724 PYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSS 788

  Rat   253 NFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGAAILRDLINEAMD 299
            .|.||:.|||....::||:|..||:|||:|.|:..|.|..||..|.:
  Fly   789 AFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAAKE 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stk4NP_001101270.1 STKc_MST1_2 26..281 CDD:132943 110/256 (43%)
Mst1_SARAH 433..480 CDD:402983
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 111/261 (43%)
S_TKc 566..817 CDD:214567 109/252 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.