DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr4 and nhr-138

DIOPT Version :9

Sequence 1:NP_001259161.1 Gene:Hr4 / 31162 FlyBaseID:FBgn0264562 Length:2123 Species:Drosophila melanogaster
Sequence 2:NP_501730.3 Gene:nhr-138 / 3565904 WormBaseID:WBGene00003728 Length:410 Species:Caenorhabditis elegans


Alignment Length:89 Identity:38/89 - (42%)
Similarity:56/89 - (62%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   907 APHEPTDEDEQPLVCMICEDKATGLHYGIITCEGCKGFFKRTVQNRRVYTCVADGTCEITKAQRN 971
            :|| |...::....|::|.|.....|||.:.|.||||||:|:|..:|.|.|:|:..||:.:..||
 Worm     2 SPH-PRVLNDNNRRCLVCGDDKASRHYGTVACNGCKGFFRRSVWEKRTYFCIANEDCEVLQQFRN 65

  Fly   972 RCQYCRFKKCIEQGMVLQAVREDR 995
            ||:.|||.||:..||..:||:.:|
 Worm    66 RCRACRFNKCVMVGMDARAVQSER 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr4NP_001259161.1 NR_DBD_DHR4_like 913..1002 CDD:143542 35/83 (42%)
NR_LBD_DHR4_like 1256..1515 CDD:132751
nhr-138NP_501730.3 NR_DBD_HNF4A 15..90 CDD:143518 35/75 (47%)
HOLI 205..374 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B99I
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.