DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tox2 and Dsp1

DIOPT Version :9

Sequence 1:XP_017447281.1 Gene:Tox2 / 311615 RGDID:735184 Length:561 Species:Rattus norvegicus
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:223 Identity:53/223 - (23%)
Similarity:84/223 - (37%) Gaps:48/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Rat   219 QSQLISQMGLRSGIAHSSP--------SPPGSKSATPSPSSSTQEEESDAH-------------- 261
            |.|:..|...::.|..:||        .|.|..:|......:.:||....|              
  Fly   155 QQQMQQQQQQQNVINSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKC 219

  Rat   262 -----FKISGEKRPSTDPGKKAKN-----------PK-------KKKK--KDPNEPQKPVSAYAL 301
                 ..:..||:...:..:|.|.           ||       ||:|  ||||.|::.:||:..
  Fly   220 AERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFW 284

  Rat   302 FFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRAS-LVS 365
            |..|.:..:|..||....||::|.:...|..:..|.||.|:...|..|..|.:.:..|:.| .::
  Fly   285 FCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIA 349

  Rat   366 KSPPDQGEAKNAQANPPAKMLPPKQPMY 393
            .|.|....:..|||...|.:....|..:
  Fly   350 MSAPSMQASMQAQAQKAALLAAAAQQQH 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tox2XP_017447281.1 None
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 10/69 (14%)
HMGB-UBF_HMG-box 275..339 CDD:238686 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.