DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3587 and DRL1

DIOPT Version :9

Sequence 1:NP_569965.1 Gene:CG3587 / 31160 FlyBaseID:FBgn0023521 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_172840.1 Gene:DRL1 / 837946 AraportID:AT1G13870 Length:302 Species:Arabidopsis thaliana


Alignment Length:319 Identity:91/319 - (28%)
Similarity:149/319 - (46%) Gaps:51/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLVVITGLPASGKSTRARQLRDHFVERGRK--VHLISENEAVPKAGF--GKNSHTGDSQKEKVV 61
            |.||||.|.|.||||..|..|.:...|...|  |.:|.|      |.|  .:|.:..:...||.:
plant     1 MALVVICGQPCSGKSIAAVTLAETLKESETKQSVRIIDE------ASFHLDRNQNYANMPAEKNL 59

  Fly    62 RSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTA 126
            |..|:|:..|.::..::||:|:.|.||||||||:|:::.:....|.|:..:.:.....:|.:|: 
plant    60 RGKLRSDVDRSVSTGEIVIVDSLNSIKGYRYELWCIARAAGIRYCVVYCDVDEAHCRQWNKERS- 123

  Fly   127 PDELPGDSERVQPVDNSDVPYTRETFDALCQRYEEPQSNNRWDSPLVVVLP-KDTLD------ME 184
                          |..:..|....|:.|.:|:|:|:..|||||||..:.| ::.:|      :|
plant   124 --------------DRGEDGYDDGIFEDLVRRFEKPERRNRWDSPLFELYPSREVIDKSSPVILE 174

  Fly   185 AIY-------KALYESQPLPPNQSTYNAPLGTTNYLFELDKIVQAIIKEI-----LGAVKIKAFG 237
            |:.       ....:.:.|.|:.:|..|.....|.|:|||:..|.||..|     |||    |..
plant   175 AVTYLTKTVDSKTQDVRILQPSIATQAARFSEANSLYELDRATQEIINAIVEQQSLGA----AIS 235

  Fly   238 QLRIPGSRNPVKVATSMNALQLNRLRQKFITSTCHASQTS---PTPLEQVPHLFVQFIN 293
            ::.:.....|:::...:...:|.|||:.|:.....:|.:.   ||..:.....||.::|
plant   236 RVTLGNELPPIEICRPIGLPELRRLRRTFVKLMGQSSLSGPPLPTDADSAKRRFVDYLN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3587NP_569965.1 KTI12 3..293 CDD:285611 89/315 (28%)
NK 3..263 CDD:302627 81/282 (29%)
DRL1NP_172840.1 KTI12 3..294 CDD:285611 89/315 (28%)
NK 3..294 CDD:302627 89/315 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1988
eggNOG 1 0.900 - - E1_COG4088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6347
Inparanoid 1 1.050 116 1.000 Inparanoid score I2023
OMA 1 1.010 - - QHG55163
OrthoDB 1 1.010 - - D1300128at2759
OrthoFinder 1 1.000 - - FOG0005231
OrthoInspector 1 1.000 - - oto3068
orthoMCL 1 0.900 - - OOG6_103506
Panther 1 1.100 - - LDO PTHR12435
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3752
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.