DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3587 and kti12

DIOPT Version :9

Sequence 1:NP_569965.1 Gene:CG3587 / 31160 FlyBaseID:FBgn0023521 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_012822024.1 Gene:kti12 / 549045 XenbaseID:XB-GENE-5813863 Length:347 Species:Xenopus tropicalis


Alignment Length:295 Identity:115/295 - (38%)
Similarity:175/295 - (59%) Gaps:27/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDL 65
            |||||:.|.|.||||:|:::|::|..:.|||||:|.::    ..|..:|:...||:|||.:|..|
 Frog    74 MPLVVLCGFPCSGKSSRSQELQEHLEQSGRKVHIIGDH----VLGVDRNAVYADSKKEKELRGSL 134

  Fly    66 KSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPDEL 130
            ::...|.||:|::||||:.||||||||||:|:.|..:|..|.:......|.:.|:|..|...:: 
 Frog   135 RAAVERKLNKEEVVILDSPNYIKGYRYELFCLIKHVQTPHCLIHCITAPEISSTWNQNRDKNEQ- 198

  Fly   131 PGDSERVQPVDNSDVPYTRETFDALCQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALYESQP 195
                            |.:|.||||.||:|.|.|.|||||||..|...:.|.:|.|..|::..:.
 Frog   199 ----------------YNQEIFDALVQRFEFPDSRNRWDSPLFTVHKDEKLPLEQICNAIFHRKA 247

  Fly   196 LPPNQSTYNAPLGTTNYLFELDKIVQAIIKEILGAVKIKAFGQ-LRIPGSRNPVKVATSMNALQL 259
            .||||||...||.:||:|.||||:.|.::..:|.|.|....|. :.:||:...|::...::..:|
 Frog   248 PPPNQSTQMQPLSSTNFLHELDKVTQEVVTTVLNAQKTSVPGDVIMVPGASEKVQLPRILSMSEL 312

  Fly   260 NRLRQKFITST-CHASQTSPTPLEQVPHLFVQFIN 293
            .||||:||:.| .|.::.    :.|:.::|||::|
 Frog   313 RRLRQQFISYTKLHPNEN----ISQLANMFVQYLN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3587NP_569965.1 KTI12 3..293 CDD:285611 112/291 (38%)
NK 3..263 CDD:302627 101/260 (39%)
kti12XP_012822024.1 KTI12 76..343 CDD:369874 112/291 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2748
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6347
Inparanoid 1 1.050 213 1.000 Inparanoid score I3542
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300128at2759
OrthoFinder 1 1.000 - - FOG0005231
OrthoInspector 1 1.000 - - oto102238
Panther 1 1.100 - - LDO PTHR12435
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3752
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.