DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3587 and Pstk

DIOPT Version :9

Sequence 1:NP_569965.1 Gene:CG3587 / 31160 FlyBaseID:FBgn0023521 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001259711.1 Gene:Pstk / 3772080 FlyBaseID:FBgn0031041 Length:292 Species:Drosophila melanogaster


Alignment Length:263 Identity:59/263 - (22%)
Similarity:102/263 - (38%) Gaps:64/263 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVITGLPASGKST------------RARQLRDHFVERGRKVHLISEN--EAVPKAGFGKNSHTG 53
            ||.:.||||:|||:            |.|.:          |||..::  :|.|.|........|
  Fly     6 LVALIGLPAAGKSSLCSWLLGQQAALRVRHI----------VHLCYDDFLDATPSADLAYKEQRG 60

  Fly    54 DSQK--EKVVR-----SDLKSEASRHLNQED------LVILDAGNYIKGYRYELYCMSKVSRTTQ 105
            ...|  ||::.     :|...:..|..:..|      |::.|...|.:..||:||.:.:.|....
  Fly    61 RIFKVIEKLISAIQEDTDWPPQVRRISSSGDYNSGRHLILCDDNFYYRSMRYKLYQLCRDSGCIF 125

  Fly   106 CTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVDNSDVPYTRETFDALCQRYEEPQSNNRWDS 170
            ..::.....:.....||.|:       |:.|| |||     ..|:    :.:|.|.|.::..|:.
  Fly   126 GQIYMASSLDSCLQANSLRS-------DATRV-PVD-----VVRQ----MNERLEVPDTSEAWER 173

  Fly   171 PLVVVLPKDTLDMEAIYKALY----ESQPLPPNQSTYNAPLGTTNYLFELDKIV---QAIIKEIL 228
            ..:.:   :.|||:....||.    ....||..::|.:.|......|.:...:|   ..:::..:
  Fly   174 NSLTL---NGLDMDTTGSALLAFIASLLDLPAMETTLDLPPAVARGLRQDQSLVHRLDLLLRTRI 235

  Fly   229 GAV 231
            ||:
  Fly   236 GAL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3587NP_569965.1 KTI12 3..293 CDD:285611 59/263 (22%)
NK 3..263 CDD:302627 59/263 (22%)
PstkNP_001259711.1 NK 4..267 CDD:302627 59/263 (22%)
AAA_33 6..165 CDD:290396 44/185 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4088
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.